PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010521357.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 323aa    MW: 35269.4 Da    PI: 8.2424
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010521357.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.42.8e-1263107147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
   XP_010521357.1  63 RESWTEPEHDKFLEALQLFDRD-WKKIEAFIG-SKTVIQIRSHAQKY 107
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.76E-1657113IPR009057Homeodomain-like
PROSITE profilePS5129413.75858112IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-661113IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-1861110IPR006447Myb domain, plants
SMARTSM007179.6E-1062110IPR001005SANT/Myb domain
PfamPF002496.2E-1063107IPR001005SANT/Myb domain
CDDcd001671.36E-765108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MVSPNPNPGG DFYLDPTGMT SSSLGPSPAA ATTTTSSAVA AGETATEDPS KKVRKPYTIT  60
KSRESWTEPE HDKFLEALQL FDRDWKKIEA FIGSKTVIQI RSHAQKYFLK VQKSGTGEHL  120
PPPRPKRKAS HPYPQKAPKN AQPQASGSLK STPGPSEPGF MFRPESSPML MNSENSADVA  180
PSWTNNNVQT ISFSPVAKGS VATNNCSSSS KNTPRTLTNK DTNDQGYHAH SLRVLPDFAQ  240
VYNFIGSVFD PYATEHLQKL KEMDPIDVET VLLLMRNLSI NLASPDFEDH RQLLSCHDIS  300
SETADHVGGT SKTLNKGKPE IST
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010521356.10.0PREDICTED: protein REVEILLE 6-like
RefseqXP_010521357.10.0PREDICTED: protein REVEILLE 6-like
RefseqXP_010521358.10.0PREDICTED: protein REVEILLE 6-like
SwissprotQ8H0W31e-154RVE6_ARATH; Protein REVEILLE 6
TrEMBLR0GMQ91e-158R0GMQ9_9BRAS; Uncharacterized protein (Fragment)
STRINGAT5G52660.21e-151(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-150MYB_related family protein